PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_AchrUn_randomP18920_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GRAS
Protein Properties Length: 428aa    MW: 48629.6 Da    PI: 5.4596
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_AchrUn_randomP18920_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS88.51.1e-271662711109
                           GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaa 80 
                                    l++ L++cA+av+++d   +++l+ +l++++s +g+p+qRl ay++e+L a+la+s+s++ykal+++e +   ss+ l++
  GSMUA_AchrUn_randomP18920_001 166 LKQILIACARAVENNDILVVEWLIPKLRQMVSVSGEPIQRLGAYLLEGLVAKLASSGSSIYKALKCKEPT---SSDLLSY 242
                                    5789*****************************************************************9...9****** PP

                           GRAS  81 lklfsevsPilkfshltaNqaIleavege 109
                                    ++++++v+P++kf+++ aN aI ea++ e
  GSMUA_AchrUn_randomP18920_001 243 MHILYDVCPYFKFGYMSANGAIAEALKDE 271
                                    *************************9976 PP

2GRAS198.25e-61268428213374
                           GRAS 213 lldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgr 292
                                    l desvs++++rd++L+++kslsP+vv++veqe+++n+++F+ rfle+++yy+a+f+s++++lpre++eri+vE+++l+r
  GSMUA_AchrUn_randomP18920_001 268 LKDESVSTRNYRDRLLQMIKSLSPTVVTLVEQESNTNTAPFFPRFLETVDYYAAIFESIDVTLPRENKERINVEQHCLAR 347
                                    56899*************************************************************************** PP

                           GRAS 293 eivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSa 372
                                    +ivn++aceg+er+erhe ++kWr+r+++aGF+p+pls  +++++k+ll+++ ++ yr+ee++g l+lgWk+r+Lv+ +a
  GSMUA_AchrUn_randomP18920_001 348 DIVNIIACEGDERVERHELFGKWRSRFMMAGFRPYPLSPLVNATIKMLLENYCEN-YRLEERDGVLYLGWKNRALVVSCA 426
                                    ****************************************************955.************************ PP

                           GRAS 373 Wr 374
                                    W+
  GSMUA_AchrUn_randomP18920_001 427 WK 428
                                    *8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098513.239140267IPR005202Transcription factor GRAS
PfamPF035141.7E-58268428IPR005202Transcription factor GRAS
PROSITE profilePS5098523.649268409IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 428 aa     Download sequence    Send to blast
MQASTNYKVL SKQHQSYNQN LGRDPESRFM PQNYLTSHCD SSADGFQQGN SHHQTIHDQF  60
YTLESSSEAA NFTTHNSPSS PSYSPISRSP ASHQDSQSDN NYDSPISYSC ITEDSNDLKH  120
KLREIEAAML GPDSDSIDSF ENAYSSYISL EQEKWQQVMG TPRGDLKQIL IACARAVENN  180
DILVVEWLIP KLRQMVSVSG EPIQRLGAYL LEGLVAKLAS SGSSIYKALK CKEPTSSDLL  240
SYMHILYDVC PYFKFGYMSA NGAIAEALKD ESVSTRNYRD RLLQMIKSLS PTVVTLVEQE  300
SNTNTAPFFP RFLETVDYYA AIFESIDVTL PRENKERINV EQHCLARDIV NIIACEGDER  360
VERHELFGKW RSRFMMAGFR PYPLSPLVNA TIKMLLENYC ENYRLEERDG VLYLGWKNRA  420
LVVSCAWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-22281428224375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009387556.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_009387557.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_009387558.10.0PREDICTED: scarecrow-like transcription factor PAT1
SwissprotQ8GVE12e-90CIGR2_ORYSJ; Chitin-inducible gibberellin-responsive protein 2
TrEMBLM0UAF10.0M0UAF1_MUSAM; Uncharacterized protein
STRINGGSMUA_AchrUn_randomP18920_0010.0(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.22e-91GRAS family protein